CELLO

From BioPerl
Jump to: navigation, search

Contents

Description

CELLO - subCELlular LOcalization predictive system [1].

Website

http://cello.life.nctu.edu.tw/

Example

Input

>1086005|Genbank|Outer membrane/Extracellular (Autotransporter)|major ring-forming surface protein precursor
MTKISDVQEKNFLKRKEKSSSLRNRKFFQPLIATTLAFSLASSFVNAADAGNAGQAPVNAEGITVTVNQANKTATVSGNNGNATFTFTNGANTTVNGT
ADPAVTAPNIEVNIANTVNNFTVDGKPANQANQNLGAEGKPVNLNFDFGGIASSGTAKTFTLNLGGAGNANALTGNLNILGAGNATLNTNTNGSIASG
GPVINVNKDATFNATFSGGATMTGNIVTGNTKETSGTGTNNITFDGPKQIPHNGSLIKDGTAVTGQADPATVLTGNISTYGGINNVTFEKGTMKGDII
AGNATGQSLGMNVVTFKEQGVHYTGNVIASGTGGVNNTLNFGNATVDATNGGNTLIIQNSGITFNNTNGVNNSPTLTHATITPAAAGGDPANQATVFQ
GNIKSAYQGVNTLNFYNFAKLEGTPANKANPAPAANITATNNGANNIVFTDGGLVNANLTSTLDQGINTLVMNTNNIVTNPILLTGNVVTNTPGWAGS
NTLLFQNNGTSSTGGNAMQTLTNQVAYVGNIVANGGSVQAIFSNTYWAPTNLKDLKEQAGGLNAAGAAGANARANAQAKSQQIQGYLDKFNGNSANAT
GNLTATNGGTATLVLRNTTTLANLPRQAAQYNVTVGGNNSSANIVLEAPVNASATITYGGYYLGGNGTSNYVWNGSQNTSSVNLIFANADNRGTPTLN
GATGSSTLVSDAFGGQFRNDLGAGKVLGVTYQNGIQMSLSDKNVTLQGQNGLYSGSFMAFFKDAILAKIAKVDSNAEFATQGIPLNVSLVKSGNGTSS
PGSGGNSFVNNITLEGVAVGSITALTNKQATGTNGMNNTSGIVNLVLKSDSVLLGTIAGENQKGLTMNMQLNQGAKLILQNSGAGTGGDVALNNLTIA
SGNNGNGNNGAAVTFQGGSVSFDKNQANDYTALQNNTVIDLATGGGSNNVPSRTWFNLLTVGQANSSNTTTASDGQQASGLGGNNALFKVYVNADANQ
GNGAGGGRGNATLNGQNSFNGSGLYGNIYSDRVIVYQTQEQHFCDRISPNPRQWKSYGVRYHGGGTERAGNVAVATVKNEGGQASVNFTTVGSVIGFD
VFDAKLTAVKTNAYGKVETNNANNAGNSTPAPGLGSIPGLGGTGGTSSGNGTGGSQDQANAQDYTTYFISQAVANTSEANQLATATALASNYYLYLAN
IDSLNKRMGELRSNPRSNGFWMRMFNGMQTTKFALQTTSIYTTVQAGWDHVFGSEGGNDFLGFAVAYAGAAMSSEKKEQLVNGAQKGVKSSGGNAFEI
SLYNSYVQDGAASSTDFKYGFYSDSVAKFSFLWNKLTMFGEDSSPNMQNFGFTFSQEIGYRFLLGNHNEWYITPQGQVALGYFNQSNIKQTLGSHWLK
GEQSSIFTVQGRIGSNFGYRFNQFTEDKGWASELYLGLWYIGDYISGGNLTLVSDLGSVNTLRTLSSTGRFAFNIGTNFVVKDNHRFYFDFERSFGGK
IITDYQFNIGYRYNFGENRKYVSLLAGSMKDTIKKDDKKENKEETEEIE

Output

SeqID: 1086005|Genbank|Outer membrane/Extracellular (Autotransporter)|major ring-forming surface protein precursor
	CELLO prediction:
			(predictor 	localization  	reliable-index)
			Composition	extracellular	0.865
			Di-peptide	extracellular	0.423
			part-Comp.	extracellular	0.761
			chemo-typy	inner membrane	0.374
			Neighboring	outer membrane	0.558

	Combined SVM classifier:
					extra cellular	2.632 <-
					outer membrane	1.440
					periplasmic	0.173
					inner membrane	0.606
					cytoplasmic	0.150

References

  1. Yu CS, Lin CJ, and Hwang JK. Predicting subcellular localization of proteins for Gram-negative bacteria by support vector machines based on n-peptide compositions. Protein Sci. 2004 May;13(5):1402-6. DOI:10.1110/ps.03479604 | PubMed ID:15096640 | HubMed [cello2004]
Personal tools
Namespaces
Variants
Actions
Main Links
documentation
community
development
Toolbox