Factor7

From BioPerl
Jump to: navigation, search
ID   HSCFVII    standard; DNA; HUM; 12850 BP.
XX
AC   J02933;
XX
SV   J02933.1
XX
DT   02-APR-1988 (Rel. 15, Created)
DT   02-JUL-1999 (Rel. 60, Last updated, Version 6)
XX
DE   Human blood coagulation factor VII gene, complete cds.
XX
KW   coagulation factor; coagulation factor VII.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Mammalia; Eutheria;
OC   Primates; Catarrhini; Hominidae; Homo.
XX
RN   [1]
RP   1-12850
RX   MEDLINE; 87260948.
RA   O'Hara P.J., Grant F.J., Haldeman B.A., Gray C.L., Insley M.Y., Hagen F.S.,
RA   Murray M.J.;
RT   "Nucleotide sequence of the gene coding for human factor VII, a vitamin
RT   K-dependent protein participating in blood coagulation";
RL   Proc. Natl. Acad. Sci. U.S.A. 84(15):5158-5162(1987).
XX
RN   [2]
RP   856-12446
RX   MEDLINE; 88329723.
RA   O'Hara P.J., Grant F.J.;
RT   "The human factor VII gene is polymorphic due to variation in repeat copy
RT   number in a minisatellite";
RL   Gene 66(1):147-158(1988).
XX
DR   GDB; 119897; F7.
DR   SWISS-PROT; P08709; FA7_HUMAN.
XX
CC   [2]  minisatellite imperfect repeats only.
CC   Draft entry and computer-readable copy of sequence in [1] kindly
CC   provided by P.J.O'Hara, 26-JUN-1987.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..12850
FT                   /db_xref="taxon:9606"
FT                   /organism="Homo sapiens"
FT                   /map="13q34"
FT   prim_transcript 487..12686
FT                   /note="factor VII pre-mRNA (alt.)"
FT   prim_transcript 487..12660
FT                   /note="factor VII pre-mRNA (alt.)"
FT   prim_transcript 487..12664
FT                   /note="factor VII pre-mRNA (alt.)"
FT   exon            <522..585
FT                   /note="factor VII; G00-119-897"
FT                   /gene="F7"
FT   gene            522..585
FT                   /gene="F7"
FT   CDS             join(522..585,1654..1719,4294..4454,6383..6407,6478..6591,
FT                   8307..8447,9419..9528,10124..10247,11064..11659)
FT                   /codon_start=1
FT                   /db_xref="SWISS-PROT:P08709"
FT                   /note="factor VII"
FT                   /protein_id="AAA51983.1"
FT                   /translation="MVSQALRLLCLLLGLQGCLAAGGVAKASGGETRDMPWKPGPHRVF
FT                   VTQEEAHGVLHRRRRANAFLEELRPGSLERECKEEQCSFEEAREIFKDAERTKLFWISY
FT                   SDGDQCASSPCQNGGSCKDQLQSYICFCLPAFEGRNCETHKDDQLICVNENGGCEQYCS
FT                   DHTGTKRSCRCHEGYSLLADGVSCTPTVEYPCGKIPILEKRNASKPQGRIVGGKVCPKG
FT                   ECPWQVLLLVNGAQLCGGTLINTIWVVSAAHCFDKIKNWRNLIAVLGEHDLSEHDGDEQ
FT                   SRRVAQVIIPSTYVPGTTNHDIALLRLHQPVVLTDHVVPLCLPERTFSERTLAFVRFSL
FT                   VSGWGQLLDRGATALELMVLNVPRLMTQDCLQQSRKVGDSPNITEYMFCAGYSDGSKDS
FT                   CKGDSGGPHATHYRGTWYLTGIVSWGQGCATVGHFGVYTRVSQYIEWLQKLMRSEPRPG
FT                   VLLRAPFP"
FT   intron          586..1653
FT                   /note="intron A1"
FT   exon            1654..1719
FT                   /note="optional"
FT   intron          1720..4293
FT                   /note="intron A"
FT   exon            4294..4454
FT                   /number=2
FT   intron          4455..6382
FT                   /note="intron B"
FT   exon            6383..6407
FT                   /number=3
FT   intron          6408..6477
FT                   /note="intron C"
FT   exon            6478..6591
FT                   /number=4
FT   intron          6592..8306
FT                   /note="Intron D"
FT   exon            8307..8447
FT                   /number=5
FT   intron          8448..9418
FT                   /note="Intron E"
FT   exon            9419..9528
FT                   /number=6
FT   intron          9529..10123
FT                   /note="Intron F"
FT   exon            10124..10247
FT                   /number=7
FT   intron          10248..11063
FT                   /note="Intron G"
FT   exon            11064..>11659
FT                   /note="factor VII"
XX
SQ   Sequence 12850 BP; 2532 A; 3888 C; 3902 G; 2528 T; 0 other;
     cccggcactt ctcagtgagg ctctgtggct cacctaagaa accagcctcc cttgcaggca        60
     acgcctagct ggcctggtct ggaggctctc ttcaaatatt tacatccaca cccaagatac       120
     ggtcttgaga tttgactcgc atgattgcta tgggacaagt tttcatctgc agtttaaatc       180
     tgtttcccaa cttacattag gggtttggaa ttctagatcg tatttgaagt gttggtgcca       240
     cacacacctt aacacctgca cgctggcaac aaaaccgtcc gctctgcagc acagctgggg       300
     tcacctgacc tttctcctgt cccccccact tgagctcagt ggctgggcag caggggatgc       360
     atggccactg gcggccaggt gcagctctca gctggggtgt tcagaggacg cctgtgtcct       420
     cccctccccc atccctctgt cacccttgga ggcagagaac tttgcccgtc agtcccatgg       480
     ggaatgtcaa caggcagggg cagcactgca gagatttcat catggtctcc caggccctca       540
     ggctcctctg ccttctgctt gggcttcagg gctgcctggc tgcaggtgcg tccggggagg       600
     ttttctccat aaacttggtg gaagggcagt gggcaaatcc aggagccagc ccgggcttcc       660
     caaaccccgc ccttgctccg gacaccccca tccaccagga gggttttctg gcggctcctg       720
     ttcaatttct ttccttctag aaaccagcat ccaggcacag gaggggaggc ccttcttggt       780
     agcccaggct ttggcgggat tatttttcaa agaactttag gagtgggtgg tgctttcctg       840
     gcccccatgg ccctgcctgt gaggtcggac aagcgcaggg agtctggggc ctctcagagt       900
     gcaggaagtg cgcacagggt gctcccaggc tggggagcac aggtagggga cggtgcgtgg       960
     gggatggcgc ctggggcatg ggggatgggg tgtgggaaac ggcatgtggg gcgtagggga      1020
     tggggtgtgg aggatcgggg gtggggatgg cgtgtggggt gtgggggatg ggccgtgggg      1080
     gggtggggcc tgggaaacag catgtggggc atggggtgtg ggggtgaggt gtgggaaagt      1140
     gtgtggggtg tgggggatgg ggcatggaaa gggcgtgtgg ggtgcagggg atggggcatg      1200
     gaggtgtggg ggatggggtg tgtggggtgt cggggatggg gcatgtgggg tgtgggggat      1260
     ggggcatgga aaggcgtgtg gggtgcagag gatggggcat ggaggtctgg ggcatggggt      1320
     gtgtggggtg tcggggatgg ggcatggaaa gggtgtgtgg ggtgtgggga tagggtcagg      1380
     ggatggcgtg gggggtgtgg catggggatg gcacgtgtgg catggggatg gggatggggg      1440
     gtggggcatg gccgagtggg gctggggctg ggaatggtga gtggggcatg gggatggcga      1500
     gtagggggtg tggcgtgagg atggctagtg gggcgtgggg atggcgtgtg gggatggcga      1560
     gtggggggtg ggctgtgagg gacagtgcct gggatgtggc tgcagcccta gctcacagca      1620
     tggccttatg accccggcca ccttcctgcc caggcggggt cgctaaggcc tcaggaggag      1680
     aaacacggga catgccgtgg aagccggggc ctcacagagg tgagcaggga ctgccactgg      1740
     ttttgtcctg gggcccagtg ggggcaacat cacctccttc ccctcccatg gcaaagagcc      1800
     agcccgcggg gtggctactg cagtgccccc caaggagggt gttccctgct cgagaggaag      1860
     tgaccgctcc agcttggcct tccctgggac tggggtgcag gcgattttat cttctttgct      1920
     ccattctgtt ccttccagat aatcgtgtgt tcttcatcag gttttcctca gttcttgaga      1980
     gcttttctga tgcaaatctg ctttcacccc agggcggtca ccggctctgc tcacaccagc      2040
     ctccaagggt gtgggtgtcc cgggagtgtg ggtgtcccgg gggcgtgggt gtcccgggag      2100
     tgtgggtgtc ccgggggcgt gggtgtcccg ggagtgtggg tgtcccgggg gcgtgggtgt      2160
     cccgggagtg tgggtgtccc gggggagtgg gtgtcccggg agtgtgggtg tcccaggggc      2220
     gtgggtgtcc cgggagtgtg ggtgtcccgg gggcgtgggt gtcccgggag tgtgggtgtc      2280
     ccggaggcga gggtgtcccg ggagtgtggg tgtcccgggg gcgtgggtgt cccgggagtg      2340
     tgggtgtccc gggggagtgg gtgtcccggg agtgtgggtg tcccaggggc gtgggtgtcc      2400
     cgggagtgtg ggtgtcccgg gggcgtgggt gtcccgggag tgtgggtgtc ccggagcgag      2460
     ggtgtcccgg gagtgtgggt gtcccggggg cgtgggtgtc ccggaggcga gggtgtccca      2520
     ggagtgtggg tgtcccgggg gcgtgggtgt cccgggagtg tgggtgtccc ggaggcgagg      2580
     gtgtcccggg agtgtgggtg tcccgggggc gtgggtgtcc cggaggcgag ggtgtcccag      2640
     gagtgtgggt gtcccggggg cgtgggtgtc ccgggagtgt gggtgttcca gaggcgaggg      2700
     tatcccagaa gtgtgagtgt cccgggggtg tgggtgtccc gggggcgtgg gtgtcccggg      2760
     agtgtgggtg tcccgggggc gtgggtatcc cagaagtgtg agtgtcccag gggcgtgggt      2820
     gtccgggggc gtgggtgtcc cgggggtgtg ggtgtcccgg gggtcgtggg tgtcccggga      2880
     gcgtgggtgt cggggactgc agggacatgg gcctcccctc ccactcctgc cgcccagggc      2940
     acctcctgtg aggactcgga gtccgtgagt tcccacctcc ttgagcccga ttctttggtg      3000
     tccccgcctg catcctcagc ctccttccaa accagaccag ttctctaggg gcgtcgacgt      3060
     gtgaaactga ttttaaagaa aacaggcggt ggcctttctc tcggccccac gtggcccagt      3120
     agcgctcacc ttccgtccct tcttccgcgc tcagtaacca atttaggccg ctcctgcaga      3180
     actcgggctc ctgcccaccg gcccacagcg tccacctgag gcctcttcct cccagcaaag      3240
     gtcgtccctc cggaacgcgc ctcctgcggc ctctccagag cccctcccgc gcgtcctctc      3300
     agccccgctc gcctcctccc ggggcctccc tctcccgcct gcccccaggc ccgtctccct      3360
     cgcgggctga ggcaggttcg gcagcacggc gcccggggcg ggggtcactc tccaccaccg      3420
     cgtggtgccc acagctcacg gcgctcccgg gtgacggtcc cctcggctgt agggcgtcct      3480
     gaagagcggc ctgctcggag ctgagcgcac ggggttgcct gcccctgggc gtctctggcc      3540
     ctcaccagcc ccgtcttccc atgggcaaaa cggcggtcct gtttgtccac aagtaaccgt      3600
     cggggttacg gaggggccag gagctgcggc ggggggctgt gctctcagga ccggccccag      3660
     gaggatccgc gcgaggtctg gagctctcag gggtcgcggg ggacagaggg gccccaagcg      3720
     gaggcgggaa ggcggcagaa gcccaggacc gccaagagct ggcgaggaag cccggggctc      3780
     gctgtcgggg gagccgggca ggggccgcgc ctcggcacca ggacgcgagg cctgggaagg      3840
     cggatctggc cgcgagcacg cggtgcgggt ggagacgcag ggatttggat ttccgcgggc      3900
     gctgcacgga tttccacgcg cggttcacgt gggccccagg gggtgcccgg cacccggggc      3960
     cgcgccgcct tctcctgccc ggcatcgacc cgcagcctca cgtttaccgc ggcgcccgca      4020
     gcccccttcg cccgcttccg cgcgtgcccc cgagcgcgcc ctcgggatca gcccccggaa      4080
     gcagagaggc caggccggga aggatgggcg aacggggtgg ctgacccggg agcacggcag      4140
     ggaggacacc cagccaggcc cgcgagcagc gccgctcccc tcctccagga cgggcgggaa      4200
     cctgcgatgc ccccgccgcg tgggccgtgg ggcggtctcc gaggcactgg gcggggcacg      4260
     cggtgggcgc ttcacggaac tcgcatttcc cagtcttcgt aacccaggag gaagcccacg      4320
     gcgtcctgca ccggcgccgg cgcgccaacg cgttcctgga ggagctgcgg ccgggctccc      4380
     tggagaggga gtgcaaggag gagcagtgct ccttcgagga ggcccgggag atcttcaagg      4440
     acgcggagag gacggtgagc ccagcctcgg ggcgccccgc gcggacactg cacggcggcg      4500
     gtgaaccagg ccgcgtgggg ccgcctgcgt ctctttggct gcggcctgtg ggcggcgaac      4560
     acgcagcggc gcccgcgcgc gcgctctctc tgcgggggtc gctttccgcc cggggtgact      4620
     ccgctttcct gggcgatgcc cccaccccca ggcacgcgct ctccccgtgc ggccgcaccg      4680
     cgcatgccgg ttttcacatc agaaaatacg atttgcacaa gcacacttag ggtgtccccc      4740
     ttaacttccc aagggagtcc ccccagtccc cgaagtccag ggcagcctgc gcatcgcaga      4800
     cgcgcgcggc tcgcagaagg gacgtggtga gaagctggcc cacagcatgc caccagcggc      4860
     acctcctcag ggcacgtgtc ggggagaaac aacacttagg gaccctggga ctttctccag      4920
     ctcacgctca cgggtccacc tcacactacc aagatcacct caatagacgg acactcacac      4980
     agggcacact tcacactcac aggtcacctc acactcacag gacacctcac actcacaggg      5040
     cacacttcac actcacgggt cacctcacac tccaagatca cctaaagagg acacctcaca      5100
     cagggcacac ttcacactca caggtcacac ctcacacaga tcatctcatt ctcacaggac      5160
     acctccctct cacaggtcac ctcacactca caggacacct cacagaggtc acctcacacc      5220
     cacaggacac ctcacagagg tcacctcaca cggggcacac ttcacactca ggtcacctca      5280
     cacccacagg acacctcaca gaggtcacct cacacccaca ggacaactca cagaggtcac      5340
     ctcacacagg acacctcaca aaggtcacct cacacccaca ggacacctca cactcatagg      5400
     cacctcagtc ttacaggaca actcacactc acaggtcacc tatctcacag gacacctcac      5460
     actcacaggt caccttactc tcacaggaca cctcacacag ggcacacttc actccacagg      5520
     tcaccatacc tcacacagat cacctcatac tcacagatca cttcattcat tctcacagga      5580
     tacctcacac tcagggcaca cttcacactc acaggtcaca cctcacacag atcatctcat      5640
     tctcacagga cacctccctc tcacaggtca ccttacactc atctcacact cacaggtcgc      5700
     cacacctcac actcacagga tgcctcacac tcacagaacc acatctcata tgcacaagac      5760
     acctcacact caggacacct catgctcaaa gaagcctcac actcacagga ggtccagctg      5820
     tctgaggcaa aggctaacat gaccctttcc agacaaattg aggatggtca tgcctagcat      5880
     ttttatacac ctagttttga aagcatttct catctgttgt attctcacag caccccgtga      5940
     gtttaagttc aggtggccaa cagtttcttc agcaatcact tttttctgtg gagtgctttt      6000
     gctgtttgtg gaatattttg catctgctac tgcaccctct ccccgtatgt gtggccaccc      6060
     tgtcagaggt ggagctgtgg ctcagagcct gtgtacctcg tcccaggtcc acagctcagc      6120
     gacagaagag tcagggttga acctcgggtg ttctgacttg ggagcaggaa atgtgtggtc      6180
     acccatagtt ccagatgtcc tggggagggg ccaagattag aagaaaccta cctcagctcc      6240
     agaggaaagt ctggcttcct gagcccaccc cgccagaccc aggtccaagt cccccaaccc      6300
     cagttcatgg tgtgtccagt gcttaccgtt gggtgctctg gtgaaggtgc atctcacgag      6360
     gcttgctctc ttgttccttc agaagctgtt ctggatttct tacagtggtg agtggatgat      6420
     caccaccagt cctgcctgca acccttctca gcttactgac accagcccac tccacagatg      6480
     gggaccagtg tgcctcaagt ccatgccaga atgggggctc ctgcaaggac cagctccagt      6540
     cctatatctg cttctgcctc cctgccttcg agggccggaa ctgtgagacg cgtaaggccc      6600
     cactttgggt cccatatttg cagagggccc tggggagctg gtggaggtgg cctggccaac      6660
     cgggctgcag ggtgcaacaa cctggtgggg tgtgtaggcc gggcattcag ggctcagccc      6720
     agttggaaat tggtctaggt gacctttaaa tcccttccag tctgaggtct ttgacaggga      6780
     cccaaggttc tgattatcag actcagtggc ccccttcgcg gtcccggccc tgggcaactt      6840
     ctcagccctg gagactggcc cagttgagag tccctgtgtc ccgtgtgccc attccagatc      6900
     ccacctagct aggtacccgt ttggtaaact tccccttctc ctactttcca ttacaaaggt      6960
     ttgaggggtt tgtttttttt tttaaccatc tgaatattaa attaatcaca aagtttaggg      7020
     cccccaacct cccttgggtt cagtaattca ctagaaggac acatagaaat ccaaatatcc      7080
     actgagtgga tacactcaca ggtaccgttt attacagcaa aggatgcagg cttaagtctg      7140
     cagagggacc agggacaagc ttccccttgt cctctcctgt ggggtcatgt ggacatcctt      7200
     aattctccca gaatgacgtg tgacgagaac gtgggaagta ctgccaaact tggggaacgc      7260
     tacgagcccc gtgtccagag gtttgatcag ggctcaatga catagaccca gctgaccagg      7320
     cacgcatggc tgacctcagt ctcagcccct ccagagctac gccgataatg cggccaaggc      7380
     cccaccatac atcacattgt cagctagacc atccagcatg gctcaaggcc caggtaaaca      7440
     ccaacattcc ctcaggcaag accttccaag ggcttagcgg tcatttccca ggagccaagg      7500
     caaaggctac cctttctctg gcacagcagt tcatccttga ccacccaaga ccacattctt      7560
     acactgaatg agctctcctg tgcagcagcc attttcttct ctaagcagaa gagagcccag      7620
     caagctggag gaggctgaag agagaggctt cctgctggtc atctgggtcc agaatgcctg      7680
     gagatctctg ctcagccctg gtgcccagca gccctggtgt gcatcctgca gggcagcctt      7740
     cccgccggag tcctggactt gctcagggcc actccccttg cccatgtcaa ccaaagtcag      7800
     gctgccggtt ctgcttcttc tgtctgagcc catgaccagt gctgggacta actgtccccc      7860
     aggcgggctc acggtggtac gaggccagct tggagaactg tctcagctct ctggtcctct      7920
     cgtcagttgg gtctctgatt ggaaagtccc ttggacactt taccatcccc attggacttt      7980
     cactttcccc caggctccca tcagctgctc ggaagagtgg tcaccctgga ggccactgcc      8040
     caccagccag gcacccccca aatgcaaccg cagccagcac tgccagccac tggcaaggct      8100
     gttcagacat gtggctcctc tgatccacgc cttgtccttt ggatcagtcc acggagcagt      8160
     gtgccaagct caggctctgt cacccacagc tcatgccacc ttccaggcag aacaccactg      8220
     ctgacccagg ggcatggcca ccccgggggc tggcgtctcg ctgaccccca gaagcccctc      8280
     tcagggtgtc cccttcctgt ccccagacaa ggatgaccag ctgatctgtg tgaacgagaa      8340
     cggcggctgt gagcagtact gcagtgacca cacgggcacc aagcgctcct gtcggtgcca      8400
     cgaggggtac tctctgctgg cagacggggt gtcctgcaca cccacaggtg accaggcttc      8460
     atgtcccagt cccagatgac accagtccct gtcccactag gattatctta ctggacaaaa      8520
     gacgggtggg actggccttc acatctactg agcactaact atgcactgac caattgtgag      8580
     gtgggatctg ggcaccaagg gtggcacagg ccagcagcga ccagtgacta ggatgggcac      8640
     cctgggggca atccctgaat ggcctcaggc cccctgccaa cttctaggca gaccagggga      8700
     gccaagcaag gcactatctc acgtccaact gcccactcgc aggaatcctc cgccagggtt      8760
     catgaatcta cttcggcaca gccaatgtct gtactgactg ctgcccactc tgcattccaa      8820
     aactcgtaaa ggctcctggg aaaatgggat gtttctccaa accagcctgg aacgaatggg      8880
     ctgcacttcc aaaagcaggg acaccccaca cccactgtct ctaaagaggc ggaacgtgcc      8940
     caccctggcc acacagcctg ggactcagcc tgccacctcc tcgggcttcc tttctggccc      9000
     aagaccttga ttgaagcaga tcaaaactaa gcatgggatc aaaacaacac agtttgattc      9060
     atctttaggt agaatttcat tcaccttcta ctaaagtcaa acaacacatc ttctccctga      9120
     aaagtgagca gagggcggtt ttaagacgta agccctctgt ttcctccaaa accagccctg      9180
     accattgtct cctcagccag ccacttcttc aagggcctct catggccggg ccccaccagt      9240
     caggcccagc cgaggccctg ccttccacca cccctgggcc ctgggagctc ctgctcctgg      9300
     gggcctccca tagcctcggc ctcaaggcct ctcagaggat gggtgtttct gaatctttcc      9360
     tagtggcacg ttcatccctc acaaatctct gcatctttct gacttttgtt ttacacagtt      9420
     gaatatccat gtggaaaaat acctattcta gaaaaaagaa atgccagcaa accccaaggc      9480
     cgaattgtgg ggggcaaggt gtgccccaaa ggggagtgtc catggcaggt aaggcttccc      9540
     ctggcttcag gattccaagc cctgagggtc ttgaagcctt ttgaatgtga acaacagctc      9600
     tggaagggaa aatgggcagg tcagcccaag cccacaggct ccaagtcagc acacctagca      9660
     cctccagctc gcggcacccc catgctttta gtggggcaag gaaggagaaa agaaaacgac      9720
     actcactgag ggtctaccct gtgcagagaa ccctgcgaga tgccccatcc gagttgtcac      9780
     gtcgtcctca cggttactct ttgaggtggg atctttgcct gatctttgca aaatcaggag      9840
     cattggatca aagctatgtg aagatcctgt gaggtgaaca gtgaaatctc acagcgacat      9900
     ttgtattctt gggccgtgcc caagagcacg tctcggctag agaggggcac agcctcccag      9960
     agccaggtct gagcagcttt gcctgggagg gatctgcaaa gaccccagga tttcagaaag     10020
     aaattgtgca atgccagagg ttccttggca tgcccgggag ggcgagtcat cagagaaaca     10080
     atgacagcaa tgtgacttcc acacctcctg tccccccgcc caggtcctgt tgttggtgaa     10140
     tggagctcag ttgtgtgggg ggaccctgat caacaccatc tgggtggtct ccgcggccca     10200
     ctgtttcgac aaaatcaaga actggaggaa cctgatcgcg gtgctgggtg ggtaccactc     10260
     tcccctgtcc gaccgcggtg ctgggtgggt gccactcttc cctgtccgac cgcggtgctg     10320
     ggtgggtgcc actctcccct gtccgaccgc ggtgctgggt gggtgccact ctcccctgtc     10380
     cgaccgcggt gctgggtggg tgccactctc cgctgtccga ccgcggtgct gggtgggtac     10440
     cactctcccc tgtctgaccg cagctctcaa gtgtctcagg ggctgtggct ctgggcttcg     10500
     tgctgtcact tccacagaca gacagacatc cccaaaaggg gagcaaccat gctgggcacg     10560
     actgcctgtg gcaccgtgct ctcagccact ttcccatgcc caaataaaac gataaaagac     10620
     tgggggcttc tgcccatcct gcctcacttg accaagagcc cagaagagga tgcgacaccc     10680
     agggcctcat gggaccaccg gctggcaggg gttctgctca ctgggtttat gggtgagacg     10740
     agcactccca ggagggccac tgggccggga agaactgtgg agaatcgggg cacgccctgt     10800
     cctcccagct gccagggcac agcatccctt ccccacctgc aacacccaga ccccagattc     10860
     accccagttc acttgtcccc acacgagcca caggctgcca cctggggcag gctggcccac     10920
     cttggggtta gatgcaggtc cccttgcccc agaaggagac tgcagcccct gcagacctag     10980
     aaatggccac agcccatccc catgcaccag ggggtgaggt ggcaggtggt ggaaagggcc     11040
     tgaggggggc ttcttccttc caggcgagca cgacctcagc gagcacgacg gggatgagca     11100
     gagccggcgg gtggcgcagg tcatcatccc cagcacgtac gtcccgggca ccaccaacca     11160
     cgacatcgcg ctgctccgcc tgcaccagcc cgtggtcctc actgaccatg tggtgcccct     11220
     ctgcctgccc gaacggacgt tctctgagag gacgctggcc ttcgtgcgct tctcattggt     11280
     cagcggctgg ggccagctgc tggaccgtgg cgccacggcc ctggagctca tggtcctcaa     11340
     cgtgccccgg ctgatgaccc aggactgcct gcagcagtca cggaaggtgg gagactcccc     11400
     aaatatcacg gagtacatgt tctgtgccgg ctactcggat ggcagcaagg actcctgcaa     11460
     gggggacagt ggaggcccac atgccaccca ctaccggggc acgtggtacc tgacgggcat     11520
     cgtcagctgg ggccagggct gcgcaaccgt gggccacttt ggggtgtaca ccagggtctc     11580
     ccagtacatc gagtggctgc aaaagctcat gcgctcagag ccacgcccag gagtcctcct     11640
     gcgagcccca tttccctagc ccagcagccc tggcctgtgg agagaaagcc aaggctgcgt     11700
     cgaactgtcc tggcaccaaa tcccatatat tcttctgcag ttaatggggt agaggagggc     11760
     atgggaggga gggagaggtg gggagggaga cagagacaga aacagagaga gacagagaca     11820
     gagagagact gagggagaga ctctgaggac atggagagag actcaaagag actccaagat     11880
     tcaaagagac taatagagac acagagatgg aatagaaaag atgagaggca gaggcagaca     11940
     ggcgctggac agaggggcag gggagtgcca aggttgtcct ggaggcagac agcccagctg     12000
     agcctcctta cctcccttca gccaagcccc acctgcacgt gatctgctgg ccctcaggct     12060
     gctgctctgc cttcattgct ggagacagta gaggcatgaa cacacatgga tgcacacaca     12120
     cacacgccaa tgcacacaca cagagatatg cacacacacg gatgcacaca cagatggtca     12180
     cacagagata cgcaaacaca ccgatgcaca cgcacataga gatatgcaca cacagatgca     12240
     cacacagata tacacatgga tgcacgcaca tgccaatgca cgcacacatc agtgcacacg     12300
     gatgcacaga gatatgcaca caccgatgtg cgcacacaca gatatgcaca cacatggatg     12360
     agcacacaca caccaagtgc gcacacacac cgatgtacac acacagatgc acacacagat     12420
     gcacacacac cgatgctgac tccatgtgtg ctgtcctctg aaggcggttg tttagctctc     12480
     acttttctgg ttcttatcca ttatcatctt cacttcagac aattcagaag catcaccatg     12540
     catggtggcg aatgccccca aactctcccc caaatgtatt tctcccttcg ctgggtgccg     12600
     ggctgcacag actattcccc acctgcttcc cagcttcaca ataaacggct gcgtctcctc     12660
     cgcacacctg tggtgcctgc cacccactgg gttgcccatg attcattttt ggagcccccg     12720
     gtgctcatcc tctgagatgc tcttttcttt cacaattttc aacatcactg aaatgaaccc     12780
     tcacatggaa gctatttttt aaaaacaaaa gctgtttgat agatgtttga ggctgtagct     12840
     cccaggatcc                                                            12850
//
Personal tools
Namespaces
Variants
Actions
Main Links
documentation
community
development
Toolbox