LipoP

From BioPerl
Jump to: navigation, search

Contents

Description

LipoP produces predictions of lipoproteins and discriminates between lipoprotein signal peptides, other signal peptides and n-terminal membrane helices in Gram negative bacteria [1].

Website

http://www.cbs.dtu.dk/services/LipoP/

Example

Input

>MY_PROTEIN_SEQ 
MKSAFSFLPNWPLAPDAIFWAGFALFAAGLCGELCYRAWRLPRITGYAVIGLVAGSFGFGVIDASTDDTSRLLVNVALGL
LLFELGSRLDLRWIRRNPWLIASSLAEATLTFVLVLAVLLLLKVPGMIALVLAAIAISTSPAMVIQLKTELRAEGQVSQR
LITLSALNSVYAVVLTKLVTSWLHQEAYGNVFATILQPIYLLAGSFIVAYLFARACNYLFRHVAATMRDEHSFVALFGLV
VLAIAVAQVLKLSTMLTLLLAGIIVKNLEARPQLWPEHFGTAGWLLTVILFVLTLTSFEGQDIAAGGLIAGALIATRFLA
KLVGVLAFAKPSGLGVKQGIALGVSLVPMSALAYLLVDDTYQLYPNFDPRLRAVVMCSIVVLQLIGPLVVYRSLSAVGER 
RDAS

Output - short

# MY_PROTEIN_SEQ TMH score=6.00601 margin=6.206923

Output - extensive

# MY_PROTEIN_SEQ TMH score=6.00601 margin=6.206923
# Cut-off=-3
MY_PROTEIN_SEQ	LipoP1.0:Best	TMH	1	1	6.00601
MY_PROTEIN_SEQ	LipoP1.0:Margin	TMH	1	1	6.206923
MY_PROTEIN_SEQ	LipoP1.0:Class	CYT	1	1	-0.200913
MY_PROTEIN_SEQ	LipoP1.0:Class	SpI	1	1	-2.05187
MY_PROTEIN_SEQ	LipoP1.0:Signal	CleavI	27	28	-2.20225	# FALFA|AGLCG

References

  1. Juncker AS, Willenbrock H, Von Heijne G, Brunak S, Nielsen H, and Krogh A. Prediction of lipoprotein signal peptides in Gram-negative bacteria. Protein Sci. 2003 Aug;12(8):1652-62. DOI:10.1110/ps.0303703 | PubMed ID:12876315 | HubMed [lipop]
Personal tools
Namespaces
Variants
Actions
Main Links
documentation
community
development
Toolbox